PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P06620_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 274aa    MW: 30689.9 Da    PI: 4.4775
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P06620_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-1853106356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k+++++ eq+++Le+ Fe ++++  e++ +LA+ lgL+ rqV vWFqNrRa++k
  GSMUA_Achr3P06620_001  53 KKRRLSVEQVRALERSFEVENKLEPERKLRLAQDLGLQPRQVAVWFQNRRARWK 106
                            456899***********************************************9 PP

2HD-ZIP_I/II130.94.9e-4252144193
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrls eqv++LE+sFe e+kLeperK +la++LglqprqvavWFqnrRAR+ktkqlE+dy++Lk++y+al+ + ++L++++e+L 
  GSMUA_Achr3P06620_001  52 EKKRRLSVEQVRALERSFEVENKLEPERKLRLAQDLGLQPRQVAVWFQNRRARWKTKQLERDYTTLKASYEALRLDYDSLHRDKESLL 139
                            69************************************************************************************** PP

            HD-ZIP_I/II  89 eelke 93 
                            ++++e
  GSMUA_Achr3P06620_001 140 AQIEE 144
                            99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.92E-1944110IPR009057Homeodomain-like
PROSITE profilePS5007117.32948108IPR001356Homeobox domain
SMARTSM003892.8E-1851112IPR001356Homeobox domain
PfamPF000465.5E-1653106IPR001356Homeobox domain
CDDcd000864.92E-1753109No hitNo description
Gene3DG3DSA:1.10.10.603.4E-1955115IPR009057Homeodomain-like
PRINTSPR000312.8E-57988IPR000047Helix-turn-helix motif
PROSITE patternPS00027083106IPR017970Homeobox, conserved site
PRINTSPR000312.8E-588104IPR000047Helix-turn-helix motif
PfamPF021831.9E-17108149IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MKRPIADLDS LMPICPSAQE SGTYGGEFQP SMDGLEDEDD CGAAAAAAAP GEKKRRLSVE  60
QVRALERSFE VENKLEPERK LRLAQDLGLQ PRQVAVWFQN RRARWKTKQL ERDYTTLKAS  120
YEALRLDYDS LHRDKESLLA QIEELKAKLT GEESLSVSSV KEEPVVSEAG TKAAASEEEP  180
PALIYKDGSS DSDSSAVLND AVLKDYDSRR RGMSSSQDAA PPATAELGSS TSSHHHMLKM  240
EEEEEFLGRE EPFTSFFSDE QPPTLNWYYP DHWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100108RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009391328.11e-176PREDICTED: homeobox-leucine zipper protein HOX4-like
SwissprotA2YWC01e-66HOX20_ORYSI; Homeobox-leucine zipper protein HOX20
SwissprotQ6Z2481e-66HOX20_ORYSJ; Homeobox-leucine zipper protein HOX20
TrEMBLM0SCC90.0M0SCC9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P06620_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.12e-55homeobox protein 16